McDonnell Genome Institute

Washington University

Transcript

lnc-SMOC2-8:2

Chromosome

chr6

Gene Name

lnc-SMOC2-8

Start

169158341

CPC Label

noncoding

End

169159433

Cancer

EOGC

Strand

+

Peptide

DSAFRPLGVTHGQAR

Modified Peptide

n[145]DSAFRPLGVTHGQAR

Peptide Length

15

ORF Length

40

Open Reading Frame (ORF)

LCLKTCRDGIRPFTRDSAFRPLGVTHGQARLQRERFTVFQ

Conservation Score

0.006

PhyloCSF Frame 1

-4.496

No. of Spectra

3

CPC Coding Probability

0.0750276

PhyloCSF Frame 2 

-4.141

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-5.322

CNTI Score

-0.345132434