McDonnell Genome Institute

Washington University

Transcript

lnc-SMOC2-1:1

Chromosome

chr6

Gene Name

lnc-SMOC2-1

Start

168672307

CPC Label

noncoding

End

168674090

Cancer

HCC

Strand

+

Peptide

KGVFLLLLETLK

Modified Peptide

KGVFLLLLETLK

Peptide Length

12

ORF Length

41

Open Reading Frame (ORF)

LLQKLEFLWSPACSYIAFQSPAATVVERKGVFLLLLETLKV

Conservation Score

0.09

PhyloCSF Frame 1

-4.645

No. of Spectra

24

CPC Coding Probability

0.159357

PhyloCSF Frame 2 

-5.673

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

-5.878

CNTI Score

-0.35684788