McDonnell Genome Institute

Washington University

Transcript

lnc-SMOC1-1:1

Chromosome

chr14

Gene Name

lnc-SMOC1-1

Start

69811761

CPC Label

coding

End

69816568

Cancer

BRCA-Luminal A

Strand

+

Peptide

LDGPSMGK

Modified Peptide

n[145]LDGPSMGK

Peptide Length

8

ORF Length

55

Open Reading Frame (ORF)

MSQLSLSAKTERRPTTVMTSTPITWGQLKKTTQEAEKLLEHQGQSVKLDGPSMGK

Conservation Score

0.279

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.629254

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5713

PhyloCSF Frame 3

0

CNTI Score

-0.366497007