McDonnell Genome Institute

Washington University

Transcript

lnc-SMNDC1-6:1

Chromosome

chr10

Gene Name

lnc-SMNDC1-6

Start

110550114

CPC Label

noncoding

End

110550854

Cancer

EOGC

Strand

-

Peptide

AGNFCVPAEPK

Modified Peptide

n[145]AGNFCVPAEPK

Peptide Length

11

ORF Length

62

Open Reading Frame (ORF)

MARMARKAGNFCVPAEPKLALIIRIRGLSGGSPRVRKVWQLLCLVRSSSETLLSSTVLQFTC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.0581872

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.369822047