McDonnell Genome Institute

Washington University

Transcript

lnc-SMNDC1-1:1

Chromosome

chr10

Gene Name

lnc-SMNDC1-1

Start

110207849

CPC Label

noncoding

End

110208591

Cancer

OV

Strand

-

Peptide

KVLMCFSIEFSLVLK

Modified Peptide

n[145]KVLMCFSIEFSLVLK

Peptide Length

15

ORF Length

67

Open Reading Frame (ORF)

LAASSRICTFCRKVLMCFSIEFSLVLKMSEKGHLGLAPAGSSGRAGGWGAATAGGTAGGAAGASPAP

Conservation Score

1

PhyloCSF Frame 1

6.584

No. of Spectra

7

CPC Coding Probability

0.230389

PhyloCSF Frame 2 

-0.436

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

1.078

CNTI Score

-0.359382026