McDonnell Genome Institute

Washington University

Transcript

lnc-SMKR1-2:2

Chromosome

chr7

Gene Name

lnc-SMKR1-2

Start

129477874

CPC Label

noncoding

End

129478101

Cancer

HCC

Strand

+

Peptide

HVQGILWGFDPLMNLVIDK

Modified Peptide

HVQGILWGFDPLMNLVIDK

Peptide Length

19

ORF Length

75

Open Reading Frame (ORF)

MSKAHPPELKKFIDKKLSLKLNGGRHVQGILWGFDPLMNLVIDKCVEMATSGQQKNIGMVVIRRNSIIMLETLEQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.096832

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5046

PhyloCSF Frame 3

0

CNTI Score

-0.399632586