McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM28-1:1

Chromosome

chr6

Gene Name

lnc-SMIM28-1

Start

138340184

CPC Label

noncoding

End

138344611

Cancer

OSCC

Strand

+

Peptide

KTFDSNSKR

Modified Peptide

n[145]KTFDSNSKR

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

MKTFDSNSKRLQIAGRRRVVNVTVIANPYLYYHT

Conservation Score

0.398

PhyloCSF Frame 1

-6.104

No. of Spectra

7

CPC Coding Probability

0.0907209

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9962

PhyloCSF Frame 3

-4.648

CNTI Score

-0.401138153