McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM2-3:1

Chromosome

chr13

Gene Name

lnc-SMIM2-3

Start

44260969

CPC Label

noncoding

End

44262930

Cancer

OV

Strand

-

Peptide

MLSCVVEVYAWTLIDASPSK

Modified Peptide

n[145]M[147]LSCVVEVYAWTLIDASPSK

Peptide Length

20

ORF Length

43

Open Reading Frame (ORF)

MLSCVVEVYAWTLIDASPSKGSFHSCCFWLDGALTVLSTSGRD

Conservation Score

0.025

PhyloCSF Frame 1

-3.867

No. of Spectra

7

CPC Coding Probability

0.217273

PhyloCSF Frame 2 

-3.535

CNTI Index

noncoding

Max Probability

0.6057

PhyloCSF Frame 3

-5.147

CNTI Score

-0.342484122