McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM2-2:3

Chromosome

chr13

Gene Name

lnc-SMIM2-2

Start

44234117

CPC Label

noncoding

End

44243192

Cancer

EOGC

Strand

-

Peptide

LNLVEVQPQFLPPK

Modified Peptide

n[145]LNLVEVQPQFLPPK

Peptide Length

14

ORF Length

35

Open Reading Frame (ORF)

LNLVEVQPQFLPPKQTVPCECLRGTLRQDSLLIHW

Conservation Score

0.042

PhyloCSF Frame 1

-5.404

No. of Spectra

8

CPC Coding Probability

0.0221051

PhyloCSF Frame 2 

-4.535

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-5.257

CNTI Score

-0.35922944