McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM2-2:1

Chromosome

chr13

Gene Name

lnc-SMIM2-2

Start

44231107

CPC Label

noncoding

End

44301021

Cancer

OV

Strand

-

Peptide

ENTGSMFLCSEAGLGR

Modified Peptide

n[145]ENTGSMFLCSEAGLGR

Peptide Length

16

ORF Length

59

Open Reading Frame (ORF)

MIKENTGSMFLCSEAGLGRGFPRVCCERQPALPPGGEEPGPRLKSHESGLENFSCNTLL

Conservation Score

1

PhyloCSF Frame 1

-4.481

No. of Spectra

1

CPC Coding Probability

0.205285

PhyloCSF Frame 2 

-4.27

CNTI Index

noncoding

Max Probability

0.9265

PhyloCSF Frame 3

-4.887

CNTI Score

-0.330811092