McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM19-3:1

Chromosome

chr8

Gene Name

lnc-SMIM19-3

Start

42484599

CPC Label

noncoding

End

42485019

Cancer

HCC

Strand

+

Peptide

EHLGLAFQTPR

Modified Peptide

n[230]EHLGLAFQTPR

Peptide Length

11

ORF Length

75

Open Reading Frame (ORF)

LAATMIQESLTWEGSQAAKGCSHIMREHLGLAFQTPRASSQLGVLLAGLHAATEHLGHAAGPETAAAQKGLQAKR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0802365

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.296289506