McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM18-5:1

Chromosome

chr8

Gene Name

lnc-SMIM18-5

Start

30417401

CPC Label

noncoding

End

30417904

Cancer

PRAD

Strand

+

Peptide

TSMLVCAAVTHSFFSSHIVFQCMDVPK

Modified Peptide

TSMLVCAAVTHSFFSSHIVFQCMDVPK

Peptide Length

27

ORF Length

48

Open Reading Frame (ORF)

LLPLLNFNLTLKFRTSMLVCAAVTHSFFSSHIVFQCMDVPKYITHFLL

Conservation Score

0.999

PhyloCSF Frame 1

-4.821

No. of Spectra

3

CPC Coding Probability

0.00683574

PhyloCSF Frame 2 

-4.878

CNTI Index

noncoding

Max Probability

0.8985

PhyloCSF Frame 3

-4.922

CNTI Score

-0.500272705