McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM17-5:4

Chromosome

chr19

Gene Name

lnc-SMIM17-5

Start

56671978

CPC Label

noncoding

End

56675326

Cancer

OSCC

Strand

+

Peptide

VAQTGLAPEK

Modified Peptide

n[145]VAQTGLAPEK

Peptide Length

10

ORF Length

44

Open Reading Frame (ORF)

LLGLSPVWEPRMRERVAQTGLAPEKSRGTDGAGLRSQDIACRGR

Conservation Score

0.524

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0503743

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8791

PhyloCSF Frame 3

0

CNTI Score

-0.328488242