McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM17-5:1

Chromosome

chr19

Gene Name

lnc-SMIM17-5

Start

56671888

CPC Label

noncoding

End

56686817

Cancer

OV

Strand

+

Peptide

LGNTARPGSPQK

Modified Peptide

n[145]LGNTARPGSPQK

Peptide Length

12

ORF Length

56

Open Reading Frame (ORF)

LGNTARPGSPQKGKKNAKRQVYSNKLLHQKSRNISNKRLGAVAHACNPSTFGGRGG

Conservation Score

0.482

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.193753

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9746

PhyloCSF Frame 3

0

CNTI Score

-0.32023016