McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM15-3:2

Chromosome

chr5

Gene Name

lnc-SMIM15-3

Start

61624401

CPC Label

noncoding

End

61628067

Cancer

PRAD

Strand

-

Peptide

APTSSLSPSFGHMPEK

Modified Peptide

APTSSLSPSFGHM[147]PEK

Peptide Length

16

ORF Length

83

Open Reading Frame (ORF)

LHPRDEADLIMVDTLCDGLPNSFKCKLKDPSTGPSPEDCTQESGGMDRGSRCLRKLHGAGKAPTSSLSPSFGHMPEKEILCLE

Conservation Score

1

PhyloCSF Frame 1

0.216

No. of Spectra

9

CPC Coding Probability

0.073614

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9419

PhyloCSF Frame 3

0

CNTI Score

-0.349234346