McDonnell Genome Institute

Washington University

Transcript

lnc-SMIM12-1:1

Chromosome

chr1

Gene Name

lnc-SMIM12-1

Start

34439615

CPC Label

noncoding

End

34685309

Cancer

CCRC

Strand

-

Peptide

MLVEEDIK

Modified Peptide

n[230]MLVEEDIK

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LFTYSCVTLGKSLCLSLLICRMLVEEDIKSNYHIVVLGG

Conservation Score

0.048

PhyloCSF Frame 1

-5.169

No. of Spectra

1

CPC Coding Probability

0.23937

PhyloCSF Frame 2 

-4.326

CNTI Index

noncoding

Max Probability

0.9923

PhyloCSF Frame 3

-5.172

CNTI Score

-0.335750956