McDonnell Genome Institute

Washington University

Transcript

lnc-SMDT1-3:28

Chromosome

chr22

Gene Name

lnc-SMDT1-3

Start

42269703

CPC Label

coding

End

42283402

Cancer

PRAD

Strand

+

Peptide

IEVWHPNLGCIHLSPWTMGPLR

Modified Peptide

IEVWHPNLGCIHLSPWTM[147]GPLR

Peptide Length

22

ORF Length

65

Open Reading Frame (ORF)

LRRDLAPNPPGPTETSALQVCPSTLPSRIEVWHPNLGCIHLSPWTMGPLRCKEFNLSQVTQFGRG

Conservation Score

0.663

PhyloCSF Frame 1

-4.058

No. of Spectra

9

CPC Coding Probability

0.767515

PhyloCSF Frame 2 

0.263

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-2.57

CNTI Score

-0.276184688