McDonnell Genome Institute

Washington University

Transcript

lnc-SMDT1-3:27

Chromosome

chr22

Gene Name

lnc-SMDT1-3

Start

42269511

CPC Label

coding

End

42283402

Cancer

OV

Strand

+

Peptide

FSVSGHAWEAAAGR

Modified Peptide

n[145]FSVSGHAWEAAAGR

Peptide Length

14

ORF Length

69

Open Reading Frame (ORF)

LAAELFANLQASQASTVAGGAPSPGLRSAKPHPSLGPRFSVSGHAWEAAAGRSSLQRPQAAQAKRMMER

Conservation Score

0.879

PhyloCSF Frame 1

-2.219

No. of Spectra

2

CPC Coding Probability

0.767515

PhyloCSF Frame 2 

-0.655

CNTI Index

noncoding

Max Probability

0.2771

PhyloCSF Frame 3

-3.273

CNTI Score

-0.276184688