McDonnell Genome Institute

Washington University

Transcript

lnc-SMCR8-2:1

Chromosome

chr17

Gene Name

lnc-SMCR8-2

Start

18311903

CPC Label

noncoding

End

18312651

Cancer

OV

Strand

+

Peptide

KTCTTVTFTK

Modified Peptide

n[145]KTCTTVTFTK

Peptide Length

10

ORF Length

76

Open Reading Frame (ORF)

LHRQDCGVKFHRKTCTTVTFTKVNFLVDKGALAKLVGQITTTYEICCHWGGNALGPKSVACITNLEKAKAKEFATK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.401262

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3206

PhyloCSF Frame 3

0

CNTI Score

-0.316326162