McDonnell Genome Institute

Washington University

Transcript

lnc-SMC6-2:1

Chromosome

chr2

Gene Name

lnc-SMC6-2

Start

17947012

CPC Label

noncoding

End

18018022

Cancer

EOGC

Strand

-

Peptide

FLESLFWTYPFSPK

Modified Peptide

n[145]FLESLFWTYPFSPK

Peptide Length

14

ORF Length

47

Open Reading Frame (ORF)

MAKFLESLFWTYPFSPKFDKIKQLFHLSLSMQCLHCQILSNFLPFSV

Conservation Score

0.658

PhyloCSF Frame 1

-5.772

No. of Spectra

14

CPC Coding Probability

0.0527225

PhyloCSF Frame 2 

-5.04

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

-5.868

CNTI Score

-0.366398227