McDonnell Genome Institute

Washington University

Transcript

lnc-SMC5-6:1

Chromosome

chr9

Gene Name

lnc-SMC5-6

Start

70217194

CPC Label

noncoding

End

70217668

Cancer

CCRC

Strand

+

Peptide

IYPGQGRHYARTDGK

Modified Peptide

IYPGQGRHYARTDGK

Peptide Length

15

ORF Length

94

Open Reading Frame (ORF)

LCSFSGYKIYPGQGRHYARTDGKVFEFLNAKCESAFLSKRNPWQINWTVLHRRKHKKGESEEIQKKRTHPAVKFQRAITGASLADIMAKRNQKP

Conservation Score

1

PhyloCSF Frame 1

-4.035

No. of Spectra

1

CPC Coding Probability

0.0479449

PhyloCSF Frame 2 

1.744

CNTI Index

noncoding

Max Probability

0.2158

PhyloCSF Frame 3

-3.41

CNTI Score

-0.327059548