McDonnell Genome Institute

Washington University

Transcript

lnc-SMARCC2-9:1

Chromosome

chr12

Gene Name

lnc-SMARCC2-9

Start

56146077

CPC Label

noncoding

End

56152469

Cancer

OSCC

Strand

-

Peptide

KVEWVGSVMWK

Modified Peptide

n[145]KVEWVGSVM[147]WK

Peptide Length

11

ORF Length

55

Open Reading Frame (ORF)

LKQEIRLNPGGGGCGEPRSCHYTPAWATRVKFCTPLKKKKKKKRKVEWVGSVMWK

Conservation Score

0.054

PhyloCSF Frame 1

0

No. of Spectra

28

CPC Coding Probability

0.0350831

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9027

PhyloCSF Frame 3

0

CNTI Score

-0.360023685