McDonnell Genome Institute

Washington University

Transcript

lnc-SMARCAD1-1:1

Chromosome

chr4

Gene Name

lnc-SMARCAD1-1

Start

94369832

CPC Label

noncoding

End

94370163

Cancer

HCC

Strand

+

Peptide

AKNNTVTPDGKPNK

Modified Peptide

AKNNTVTPDGKPNK

Peptide Length

14

ORF Length

108

Open Reading Frame (ORF)

LEGCCPSHFAVYKRGLWNQREHTALLKIEGVYSRDEAEFYLSKRCVYVYKAKNNTVTPDGKPNKTRVIWGKVTLAHGNSGMVHAKFQSNLTAKAIGHRVRVMLHPSRI

Conservation Score

1

PhyloCSF Frame 1

-3.17

No. of Spectra

1

CPC Coding Probability

0.0406478

PhyloCSF Frame 2 

-2.787

CNTI Index

noncoding

Max Probability

0.1619

PhyloCSF Frame 3

-3.258

CNTI Score

-0.439134051