McDonnell Genome Institute

Washington University

Transcript

lnc-SMARCA2-6:1

Chromosome

chr9

Gene Name

lnc-SMARCA2-6

Start

2213893

CPC Label

noncoding

End

2293037

Cancer

BRCA-Basal-like

Strand

+

Peptide

GTAEGHSRETGR

Modified Peptide

n[145]GTAEGHSRETGR

Peptide Length

12

ORF Length

120

Open Reading Frame (ORF)

MRTGIPVFALKKLPFGLLRSLSCTHINLKPQAPGADQQMKRSRGTAEGHSRETGRGTFSWGWLERSLAAGQPNSRGRSSSHSIPHFRFPIHPAKSHLHHSTKPCVDPSSPCVTRYSRDAG

Conservation Score

0.068

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.234072

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.311572284