McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD7-4:3

Chromosome

chr18

Gene Name

lnc-SMAD7-4

Start

48673574

CPC Label

noncoding

End

48688419

Cancer

OV

Strand

-

Peptide

MSVGGILAGDLLEK

Modified Peptide

n[145]M[147]SVGGILAGDLLEK

Peptide Length

14

ORF Length

117

Open Reading Frame (ORF)

MSVGGILAGDLLEKEHFQGGFPLPPSVLRCQRPPLQRFCTQGTNSSPCRPLPSTLWMVHLPHTQSSALEGKIWNTEPRASPHPGPLGYHGLRWQGHRTQSTWTLESPRSYPGDQLDP

Conservation Score

0.99

PhyloCSF Frame 1

-2.478

No. of Spectra

4

CPC Coding Probability

0.102498

PhyloCSF Frame 2 

-3.694

CNTI Index

noncoding

Max Probability

0.8168

PhyloCSF Frame 3

-4.253

CNTI Score

-0.374840586