McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD7-2:2

Chromosome

chr18

Gene Name

lnc-SMAD7-2

Start

48812915

CPC Label

coding

End

48834821

Cancer

BRCA-Luminal A

Strand

-

Peptide

GLGATLLCR

Modified Peptide

n[145]GLGATLLCR

Peptide Length

9

ORF Length

88

Open Reading Frame (ORF)

MGHTSTRKGSPVLLRMVPKTSHRKVMKPSQRSTSCCCSSSRTVKSFCGGMRDRVSLPGLGRGLGATLLCRASVVLGLLLGSRQTPCFK

Conservation Score

1

PhyloCSF Frame 1

-4.433

No. of Spectra

1

CPC Coding Probability

0.533467

PhyloCSF Frame 2 

-0.364

CNTI Index

noncoding

Max Probability

0.5161

PhyloCSF Frame 3

12.753

CNTI Score

-0.313201066