McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD7-1:3

Chromosome

chr18

Gene Name

lnc-SMAD7-1

Start

48961067

CPC Label

noncoding

End

48976543

Cancer

BRCA-Luminal A

Strand

-

Peptide

HAPIPKPMSSGSSSWK

Modified Peptide

n[145]HAPIPKPMSSGSSSWK

Peptide Length

16

ORF Length

38

Open Reading Frame (ORF)

MGIGQWGLRPYLPREGEDLGRHAPIPKPMSSGSSSWKS

Conservation Score

0.164

PhyloCSF Frame 1

-3.137

No. of Spectra

94

CPC Coding Probability

0.141795

PhyloCSF Frame 2 

-4.032

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-4.191

CNTI Score

-0.369366693