McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD7-1:2

Chromosome

chr18

Gene Name

lnc-SMAD7-1

Start

48962950

CPC Label

noncoding

End

48963941

Cancer

EOGC

Strand

-

Peptide

MQPAEIPQLGS

Modified Peptide

n[145]MQPAEIPQLGS

Peptide Length

11

ORF Length

87

Open Reading Frame (ORF)

LYFSCWGGIYSASPVLLHLQGQWRTPGDSWLRSRINVKEFLHRLHHQILLNMLCPFQEKKRNECELFLYIQPFTQKMQPAEIPQLGS

Conservation Score

0.213

PhyloCSF Frame 1

-3.412

No. of Spectra

1

CPC Coding Probability

0.0110286

PhyloCSF Frame 2 

-4.026

CNTI Index

noncoding

Max Probability

0.9931

PhyloCSF Frame 3

-5.237

CNTI Score

-0.405012655