McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD7-1:1

Chromosome

chr18

Gene Name

lnc-SMAD7-1

Start

48959509

CPC Label

noncoding

End

48965137

Cancer

CRC

Strand

-

Peptide

VYCICNYAASNCCK

Modified Peptide

VYCICNYAASNCCK

Peptide Length

14

ORF Length

60

Open Reading Frame (ORF)

MHRVYCICNYAASNCCKGTSGKDCPSSQCVCVYVHVIHVHIMKITYMYNCIIYIYNCIRI

Conservation Score

0.042

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.395606

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6707

PhyloCSF Frame 3

0

CNTI Score

-0.407114251