McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD6-2:8

Chromosome

chr15

Gene Name

lnc-SMAD6-2

Start

66842568

CPC Label

noncoding

End

66847595

Cancer

PRAD

Strand

+

Peptide

LSDCMNLEELLK

Modified Peptide

LSDCM[147]NLEELLK

Peptide Length

12

ORF Length

33

Open Reading Frame (ORF)

LSDCMNLEELLKRSELPFPYLAKYTGSTNSYES

Conservation Score

0.061

PhyloCSF Frame 1

-5.855

No. of Spectra

3

CPC Coding Probability

0.354601

PhyloCSF Frame 2 

-3.616

CNTI Index

noncoding

Max Probability

0.8431

PhyloCSF Frame 3

-4.104

CNTI Score

-0.360846589