McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD6-2:4

Chromosome

chr15

Gene Name

lnc-SMAD6-2

Start

66842568

CPC Label

coding

End

66864755

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

AGAGLVK

Modified Peptide

n[145]AGAGLVK

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

LLKCQPQRMGHRGACPGTRAKCRRGMRAGAGLVKCLLGMI

Conservation Score

1

PhyloCSF Frame 1

-4.011

No. of Spectra

87

CPC Coding Probability

0.705988

PhyloCSF Frame 2 

-3.206

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

-2.335

CNTI Score

-0.259601617