McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD6-2:1

Chromosome

chr15

Gene Name

lnc-SMAD6-2

Start

66860302

CPC Label

noncoding

End

66867023

Cancer

OV

Strand

+

Peptide

EDGSELK

Modified Peptide

n[145]EDGSELK

Peptide Length

7

ORF Length

33

Open Reading Frame (ORF)

LGKETQGEVRREDGSELKSREEPGAWSLGLPVL

Conservation Score

0.099

PhyloCSF Frame 1

-5.75

No. of Spectra

2

CPC Coding Probability

0.20331

PhyloCSF Frame 2 

-5.024

CNTI Index

noncoding

Max Probability

0.5886

PhyloCSF Frame 3

0

CNTI Score

-0.309867497