McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD3-6:1

Chromosome

chr15

Gene Name

lnc-SMAD3-6

Start

67348774

CPC Label

noncoding

End

67358495

Cancer

EOGC

Strand

+

Peptide

DGVSPFWPGWSRTPDLK

Modified Peptide

n[145]DGVSPFWPGWSRTPDLK

Peptide Length

17

ORF Length

116

Open Reading Frame (ORF)

LLLRSLWTIEESVVDRARSPNIEYLNEAGERILYYHYYYYYFKTESHLLCCPGWSAVHYVDSLQPLPPGFKRFSRLSLPGSWDYRCLPPCPANFCIFSRDGVSPFWPGWSRTPDLK

Conservation Score

0.987

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.200658

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.114

PhyloCSF Frame 3

0

CNTI Score

-0.415095488