McDonnell Genome Institute

Washington University

Transcript

lnc-SMAD2-400:1

Chromosome

chr18

Gene Name

lnc-SMAD2-400

Start

48026886

CPC Label

coding

End

48029175

Cancer

OV

Strand

-

Peptide

AGVPNPCAMGTKR

Modified Peptide

n[145]AGVPNPCAM[147]GTKR

Peptide Length

13

ORF Length

172

Open Reading Frame (ORF)

MFSWFLNLQQVLKRKALLAPCLPDLLSPSLPSLFLPSLLWFLSSPERRRVRPQGEPRAGVPNPCAMGTKRLQLFLLPWLFPEQKHNKQKGQRRAQTLSLSQLSRRDPLILHTTGCHSSQQDCYTHPLFSEVICLGSRLSDSCLRFRHFSLKHAHVHQPTCPRVPPHQPSDWG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.866914

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5831

PhyloCSF Frame 3

0

CNTI Score

-0.319059469