McDonnell Genome Institute

Washington University

Transcript

lnc-SLX4IP-36:1

Chromosome

chr20

Gene Name

lnc-SLX4IP-36

Start

10902283

CPC Label

noncoding

End

10914535

Cancer

OSCC

Strand

+

Peptide

YSVWMDGNNSAGDLEALK

Modified Peptide

n[145]YSVWMDGNNSAGDLEALK

Peptide Length

18

ORF Length

63

Open Reading Frame (ORF)

LLAKVGPYIMGAPFARMKYSVWMDGNNSAGDLEALKGSVANGQVIPGTCMSGGRPFLQTCTEL

Conservation Score

0.188

PhyloCSF Frame 1

-4.581

No. of Spectra

2

CPC Coding Probability

0.0322739

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7659

PhyloCSF Frame 3

-6.013

CNTI Score

-0.354904186