McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:5

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29074975

CPC Label

coding

End

29116718

Cancer

BRCA-Luminal A

Strand

+

Peptide

LENHVATDEDEPALK

Modified Peptide

n[145]LENHVATDEDEPALK

Peptide Length

15

ORF Length

96

Open Reading Frame (ORF)

LENHVATDEDEPALKCQRLEINCQDPSIKSFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLRTTQMCNKVRW

Conservation Score

1

PhyloCSF Frame 1

-3.558

No. of Spectra

1

CPC Coding Probability

1

PhyloCSF Frame 2 

10.198

CNTI Index

coding

Max Probability

0.7844

PhyloCSF Frame 3

-4.788

CNTI Score

0.696953942