McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:25

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29291219

CPC Label

coding

End

29372110

Cancer

HCC

Strand

+

Peptide

VEGPPVISK

Modified Peptide

VEGPPVISK

Peptide Length

9

ORF Length

48

Open Reading Frame (ORF)

LSWGVQDQPGQHNEISALLKIIIIKKKKNGPTFHWQGRVEGPPVISKS

Conservation Score

0.47

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.999949

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.5399

PhyloCSF Frame 3

0

CNTI Score

0.84095929