McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:21

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29259921

CPC Label

coding

End

29330050

Cancer

OV

Strand

+

Peptide

GLMDMLACEASRELMLGTGAVGEQR

Modified Peptide

n[145]GLM[147]DM[147]LACEASRELMLGTGAVGEQR

Peptide Length

25

ORF Length

75

Open Reading Frame (ORF)

LRSRGLMDMLACEASRELMLGTGAVGEQRREKPCLRGLTVGTEPPAQVPVSKTVDTCTPWHVEHQGLRCVCWQWL

Conservation Score

0.027

PhyloCSF Frame 1

-4.333

No. of Spectra

108

CPC Coding Probability

0.784781

PhyloCSF Frame 2 

-4.532

CNTI Index

coding

Max Probability

0.7454

PhyloCSF Frame 3

-4.692

CNTI Score

0.799090326