McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:20

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29259921

CPC Label

noncoding

End

29281654

Cancer

EOGC

Strand

+

Peptide

LDTASLHQGGSALVTEQR

Modified Peptide

n[145]LDTASLHQGGSALVTEQR

Peptide Length

18

ORF Length

87

Open Reading Frame (ORF)

LELDGLQGPLRVSPMGRLDTASLHQGGSALVTEQRAAPPVFVFPIAASQALGQASFPSDKAWGGRTQCKQSCLTHRKGGKQEFTQKL

Conservation Score

0.076

PhyloCSF Frame 1

-3.773

No. of Spectra

17

CPC Coding Probability

0.45675

PhyloCSF Frame 2 

-4.461

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-4.316

CNTI Score

-0.35303968