McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:19

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29212058

CPC Label

noncoding

End

29214137

Cancer

OV

Strand

+

Peptide

ILFHGFLQSHGVR

Modified Peptide

n[145]ILFHGFLQSHGVR

Peptide Length

13

ORF Length

123

Open Reading Frame (ORF)

LLLAKGRVLTTFTWRPPSPGGRPPPSPGGCPCSFRILFHGFLQSHGVRAHMWAMRTFPLHPNTSLPVLPAPPTRRRACDPVGGCMVRVCNFVRSSNSRSGPQTRSVSIAWCCGLDVCPLHISC

Conservation Score

0.96

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0511892

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9807

PhyloCSF Frame 3

0

CNTI Score

-0.330165077