McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:18

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29154315

CPC Label

coding

End

29333056

Cancer

OV

Strand

+

Peptide

LCCQGMGALMGGSEGAK

Modified Peptide

n[145]LCCQGM[147]GALM[147]GGSEGAK

Peptide Length

17

ORF Length

137

Open Reading Frame (ORF)

LCCQGMGALMGGSEGAKASQCEPQSRTGFPHHGNAQAWKGEGGAWGLHLLLRRISAAFALWRKHALPPPPPHPLQMVIFCTRMCMLMVVIFAQITLLEKGGFAPVYCHQTHKLACFLILDKKSDHWLNTPVRMVFTK

Conservation Score

0.06

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.533236

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.3768

PhyloCSF Frame 3

0

CNTI Score

0.787217738