McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:11

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29116126

CPC Label

noncoding

End

29217860

Cancer

BRCA-Luminal A

Strand

+

Peptide

SLHPAGVTHR

Modified Peptide

n[145]SLHPAGVTHR

Peptide Length

10

ORF Length

57

Open Reading Frame (ORF)

LWYLHLSHNLQLSSTKGWTLVPPHGSREACCEVKEARHKSLHPAGVTHRTILEDAKL

Conservation Score

0.034

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.00893045

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7008

PhyloCSF Frame 3

0

CNTI Score

-0.338074842