McDonnell Genome Institute

Washington University

Transcript

lnc-SLX1B-3:10

Chromosome

chr16

Gene Name

lnc-SLX1B-3

Start

29113059

CPC Label

noncoding

End

29116291

Cancer

LUAD

Strand

+

Peptide

SFLYSINQTICLR

Modified Peptide

n[230]SFLYSINQTICLR

Peptide Length

13

ORF Length

71

Open Reading Frame (ORF)

LKCQRLEINCQDPSIKSFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSP

Conservation Score

1

PhyloCSF Frame 1

-3.558

No. of Spectra

3

CPC Coding Probability

0.0125639

PhyloCSF Frame 2 

10.198

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-5.131

CNTI Score

-0.315777228