McDonnell Genome Institute

Washington University

Transcript

lnc-SLTM-4:1

Chromosome

chr15

Gene Name

lnc-SLTM-4

Start

58967045

CPC Label

noncoding

End

58967808

Cancer

CRC

Strand

-

Peptide

NQNPIQDTTLDFNVMSYCR

Modified Peptide

NQNPIQDTTLDFNVMSYCR

Peptide Length

19

ORF Length

48

Open Reading Frame (ORF)

LPKNQNPIQDTTLDFNVMSYCRLLLVVVVSQTFLVFDDLDSLKSSSQK

Conservation Score

0.999

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0639228

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7496

PhyloCSF Frame 3

0

CNTI Score

-0.4100873