McDonnell Genome Institute

Washington University

Transcript

lnc-SLMAP-4:1

Chromosome

chr3

Gene Name

lnc-SLMAP-4

Start

57941817

CPC Label

noncoding

End

57942304

Cancer

BRCA-Luminal B

Strand

+

Peptide

ISFELFADK

Modified Peptide

n[145]ISFELFADK

Peptide Length

9

ORF Length

129

Open Reading Frame (ORF)

MVNPTMVFDIAVNDKPLGRISFELFADKFPKTTENFHALSTGEKRFGCKGSCFHRIIPGFVCQGGDFTCHTGGTSIYREKFDCKNFILKHIGPGILSMANAGPNTSGSQFSCALPRLSGWMASMWPLAW

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.474665

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.34073101