McDonnell Genome Institute

Washington University

Transcript

lnc-SLITRK5-25:1

Chromosome

chr13

Gene Name

lnc-SLITRK5-25

Start

86067697

CPC Label

noncoding

End

86071477

Cancer

OV

Strand

+

Peptide

LYIFFTHESTNEPK

Modified Peptide

n[145]LYIFFTHESTNEPK

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

LYIFFTHESTNEPKLNNNNHNNNKTEGKCEVLICLLLFFQ

Conservation Score

0.03

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0558973

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9277

PhyloCSF Frame 3

0

CNTI Score

-0.480471379