McDonnell Genome Institute

Washington University

Transcript

lnc-SLITRK5-16:1

Chromosome

chr13

Gene Name

lnc-SLITRK5-16

Start

87219003

CPC Label

noncoding

End

87219269

Cancer

HCC

Strand

+

Peptide

GGVQIFVK

Modified Peptide

n[230]GGVQIFVK

Peptide Length

8

ORF Length

65

Open Reading Frame (ORF)

LHLVFCLRGGVQIFVKTLTGKTVTLEVDSDIIENVKPRSRIKKTSSRPAEAHLHRQAAGRCPHSF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

215

CPC Coding Probability

0.018142

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.353371001