McDonnell Genome Institute

Washington University

Transcript

lnc-SLITRK5-1:2

Chromosome

chr13

Gene Name

lnc-SLITRK5-1

Start

87683510

CPC Label

noncoding

End

87697210

Cancer

OV

Strand

+

Peptide

LHLLHFSYGILIEK

Modified Peptide

n[145]LHLLHFSYGILIEK

Peptide Length

14

ORF Length

35

Open Reading Frame (ORF)

LHLLHFSYGILIEKWSAFLTVAFFHMCGYVYADIS

Conservation Score

0.087

PhyloCSF Frame 1

-6.814

No. of Spectra

17

CPC Coding Probability

0.073767

PhyloCSF Frame 2 

-5.559

CNTI Index

coding

Max Probability

0.9186

PhyloCSF Frame 3

-6.156

CNTI Score

0.587672875