McDonnell Genome Institute

Washington University

Transcript

lnc-SLITRK5-1:1

Chromosome

chr13

Gene Name

lnc-SLITRK5-1

Start

87681684

CPC Label

noncoding

End

87688283

Cancer

LUAD

Strand

+

Peptide

LNGNLPLR

Modified Peptide

n[272]LNGNLPLR

Peptide Length

8

ORF Length

33

Open Reading Frame (ORF)

MLNGNLPLRFFFFFFFGIFISNHEEILYISIIK

Conservation Score

0.059

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0233912

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5989

PhyloCSF Frame 3

0

CNTI Score

-0.455073011