McDonnell Genome Institute

Washington University

Transcript

lnc-SLITRK1-7:1

Chromosome

chr13

Gene Name

lnc-SLITRK1-7

Start

82754658

CPC Label

coding

End

82761127

Cancer

PRAD

Strand

-

Peptide

EGAAQAANPGK

Modified Peptide

Peptide Length

11

ORF Length

41

Open Reading Frame (ORF)

MQQHLCRKEGAAQAANPGKGVQQIPRNMPGMEWRLHCFTTS

Conservation Score

0.274

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.779717

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1873

PhyloCSF Frame 3

0

CNTI Score

-0.362337286